Xrcc2 (NM_020570) Mouse Recombinant Protein

CAT#: TP523996

Purified recombinant protein of Mouse X-ray repair complementing defective repair in Chinese hamster cells 2 (Xrcc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR223996 representing NM_020570
Red=Cloning site Green=Tags(s)

MCSDFRRAESGTELLARLEGRSSLKELEPNLFADEDSPVHGDIFEFHGPEGTGKTEMLYHLTARCILPKS
EGGLQIEVLFIDTDYHFDMLRLVTVLEHRLSQSSEEAMKLCLARLFLAYCSSSMQLLLTLHSLEALLCSR
PSLCLLIVDSLSSFYWIDRVSGGESVALQESTLQKCSQLLERLVTEYRLLLFATTQSLMQKGSDSADGPS
SSKHPCDGDMGYRAYLCKAWQRVVKHRVIFSRDDEAKSSRFSLVSRHLKSNSLKKHSFMVRESGVEFC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_065595
Locus ID 57434
UniProt ID Q9CX47
Refseq Size 3230
Cytogenetics 5 B1
Refseq ORF 834
Synonyms 4921524O04Rik; 8030409M04Rik; RAD51; RecA
Summary Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...