Atp6v1g3 (NM_177397) Mouse Recombinant Protein
CAT#: TP523489
Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V1 subunit G3 (Atp6v1g3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR223489 protein sequence
Red=Cloning site Green=Tags(s) MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQAKIMGSQSHLS DEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRATN myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 13.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_796371 |
| Locus ID | 338375 |
| UniProt ID | Q8BMC1 |
| Refseq Size | 1887 |
| Cytogenetics | 1 E4 |
| Refseq ORF | 354 |
| Synonyms | MGC130213; MGC130214 |
| Summary | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Atp6v1g3产品
