Ift57 (NM_028680) Mouse Recombinant Protein

CAT#: TP522797

Purified recombinant protein of Mouse intraflagellar transport 57 (Ift57), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222797 representing NM_028680
Red=Cloning site Green=Tags(s)

MAAAAAVIPPSGLDDGVSRARGEGAGEAVVERGPGAAYHMFVVMEDLVEKLKLLRYEEELLRKSNLKPPS
RHYFALPTNPGEQFYMFCTLAAWLINKTGRAFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGY
GEQVCYVLDCLAEEALKYIGFTWKRPSYPVEELEEETVPEDDAELTLSKVDEEFVEEETDNEENFIDLNV
LKAQTYRLDTNESAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALK
ETKGFLDKLHNEISRTLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERTRLLSEVT
EELEKVKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIGVVEHTLLQSKLKEKCNMTRDMHAAV
TPESAIGFY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082956
Locus ID 73916
UniProt ID Q8BXG3
Refseq Size 2540
Cytogenetics 16 B5
Refseq ORF 1287
Synonyms 4833420A15Rik; Esrrbl1; Hippi; MHS4R2
Summary Required for the formation of cilia. Plays an indirect role in sonic hedgehog signaling, cilia being required for all activity of the hedgehog pathway. Has pro-apoptotic function via its interaction with HIP1, leading to recruit caspase-8 (CASP8) and trigger apoptosis. Has the ability to bind DNA sequence motif 5'-AAAGACATG-3' present in the promoter of caspase genes such as CASP1, CASP8 and CASP10, suggesting that it may act as a transcription regulator; however the relevance of such function remains unclear.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...