Mpp5 (NM_019579) Mouse Recombinant Protein

CAT#: TP522682

Purified recombinant protein of Mouse membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) (Mpp5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222682 protein sequence
Red=Cloning site Green=Tags(s)

MTTSYMNGHVTEESDSGIKNLDLASPEEYPKHREMAVDCPGDLGTRMMPVRRSAQLERIRQQQEDMRRRR
EEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVNILDVEDLFSSLKHIQHTLVD
SQSQEDISLLLQLVQNRDFQNAFKIHNAVTVHMSKASPPFPLIANVQDLVQEVQTVLKPVHQKEGQELTA
LLNAPHIQALLLAHDKVAEQEMQLEPITDERVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVII
SRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHV
KAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNC
GQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSI
DSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTRE
MEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 77.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062525
Locus ID 56217
UniProt ID Q9JLB2
Refseq Size 5529
Cytogenetics 12 C3
Refseq ORF 2025
Synonyms 3830420B02Rik; AI255216; AI644496; Pals1
Summary Plays a role in tight junction biogenesis and in the establishment of cell polarity in epithelial cells (By similarity). Also involved in adherens junction biogenesis by ensuring correct localization of the exocyst complex protein EXOC4/SEC8 which allows trafficking of adherens junction structural component CDH1 to the cell surface (PubMed:17182851, PubMed:20237282). Plays a role through its interaction with CDH5 in vascular lumen formation and endothelial membrane polarity (By similarity). Required during embryonic and postnatal retinal development (PubMed:22398208). Required for the maintenance of cerebellar progenitor cells in an undifferentiated proliferative state, preventing premature differentiation, and is required for cerebellar histogenesis, fissure formation and cerebellar layer organization (PubMed:26657772). Plays a role in the radial and longitudinal extension of the myelin sheath in Schwann cells (PubMed:20237282). May modulate SC6A1/GAT1-mediated GABA uptake by stabilizing the transporter (PubMed:15234345). May play a role in the T-cell receptor-mediated activation of NF-kappa-B (By similarity). Required for localization of EZR to the apical membrane of parietal cells and may play a role in the dynamic remodeling of the apical cytoskeleton (PubMed:15677456). Required for the normal polarized localization of the vesicular marker STX4 (PubMed:20237282). Required for the correct trafficking of the myelin proteins PMP22 and MAG (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...