H1f1 (NM_030609) Mouse Recombinant Protein

CAT#: TP522328

Purified recombinant protein of Mouse histone cluster 1, H1a (Hist1h1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222328 protein sequence
Red=Cloning site Green=Tags(s)

MSETAPVAQAASTATEKPAAAKKTKKPAKAAAPRKKPAGPSVSELIVQAVSSSKERSGVSLAALKKSLAA
AGYDVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLNKKAESKAITTKVSVKAKASGAAKKPKKTAG
AAAKKTVKTPKKPKKPAVSKKTSKSPKKPKVVKAKKVAKSPAKAKAVKPKASKAKVTKPKTPAKPKKAAP
KKK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 21.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_085112
Locus ID 80838
UniProt ID P43275
Refseq Size 745
Cytogenetics 13 A3.1
Refseq ORF 639
Synonyms H1; H1-1; H1.1; H1a; H1v; H1var3; Hist1; Hist1h1a
Summary Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...