Dynlrb1 (NM_025947) Mouse Recombinant Protein
CAT#: TP522083
Purified recombinant protein of Mouse dynein light chain roadblock-type 1 (Dynlrb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR222083 representing NM_025947
Red=Cloning site Green=Tags(s) MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR IRSKKNEIMVAPDKDYFLIVIQNPTE myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 11.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_080223 |
| Locus ID | 67068 |
| UniProt ID | P62627 |
| Refseq Size | 702 |
| Cytogenetics | 2 H1 |
| Refseq ORF | 288 |
| Synonyms | 2010012N15Rik; 2010320M17Rik; 9430076K19Rik; AV124457; Dncl2a; DNLC2A; km23-1 |
| Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Dynlrb1产品
