Faap20 (NM_001190445) Mouse Recombinant Protein

CAT#: TP521998

Purified recombinant protein of Mouse Fanconi anemia core complex associated protein 20 (Faap20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221998 representing NM_001190445
Red=Cloning site Green=Tags(s)

MEEERRLRGRLSRRRPPAGGGPPNCRPWFLSEGSKSEPWAALLRSTVSGTADWTPNRQPLPPLPAFPSQE
SLPDPESTVPPEAFTVGSKTFSWTPLPPALRGSGSSRHLFCEPEGSLGSPTPSLKGCPALNSGRTPSAQE
CVPVQSPLALLSCPLCQKAFDPKLTQLDVDSHLAQCLAECTEDVVW

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001177374
Locus ID 67513
UniProt ID Q3UN58
Refseq Size 1076
Cytogenetics 4 E2
Refseq ORF 558
Synonyms 2610002J02Rik
Summary Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...