Tnnt1 (NM_011618) Mouse Recombinant Protein

CAT#: TP521578

Purified recombinant protein of Mouse troponin T1, skeletal, slow (Tnnt1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221578 representing NM_011618
Red=Cloning site Green=Tags(s)

MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRM
EKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAK
KRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELS
EWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035748
Locus ID 21955
UniProt ID O88346
Refseq Size 1027
Cytogenetics 7 2.6 cM
Refseq ORF 783
Synonyms AW146156; ss; ssTnT; sT; sTnT; Tn; Tnt
Summary This gene encodes the slow skeletal tropomyosin-binding subunit of the troponin complex and plays an essential role in the regulation of striated muscle contraction. In humans, mutations in this gene are associated with nemaline myopathy type 5. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...