Hormad2 (NM_029458) Mouse Recombinant Protein

CAT#: TP520735

Purified recombinant protein of Mouse HORMA domain containing 2 (Hormad2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220735 representing NM_029458
Red=Cloning site Green=Tags(s)

MATAQLSHNTRTLKASKNTIFPSQVTNEHESLVVVKKLFATCISCITYLRGLFPESSYRDRRLDDLSLKI
LREDKKCPGSLHIIKWIQGCFDALEKRYLHMAVLTLYTNPKEPEKVTEIYQFRFKYTKKGTTMDFDSSST
SFESGTDSEDIKKACSLLIRQLYILMQNLGPLPNDVILTMKLHYYNSVTPHDYQPPGFKEAVNSHFLLFE
GEPVSLRMGSVSSGFHSMKVKVTTEATRMLDGENSVSQDDGTTEIAHQGLDCDEEEEACGSQVQRMNFVH
IEPSFESSRKKKKVSEPVTVFIPNRK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083734
Locus ID 75828
UniProt ID Q5SQP1
Refseq Size 1343
Cytogenetics 11 A1
Refseq ORF 918
Synonyms 4930529M09Rik
Summary Essential for synapsis surveillance during meiotic prophase via the recruitment of ATR activity. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes. Required for the DNA double-strand break-independent, BRCA1-dependent activation of ATR on the sex chromosomes that is essential for normal sex body formation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...