Hormad2 (NM_029458) Mouse Recombinant Protein
CAT#: TP520735
Purified recombinant protein of Mouse HORMA domain containing 2 (Hormad2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220735 representing NM_029458
Red=Cloning site Green=Tags(s) MATAQLSHNTRTLKASKNTIFPSQVTNEHESLVVVKKLFATCISCITYLRGLFPESSYRDRRLDDLSLKI LREDKKCPGSLHIIKWIQGCFDALEKRYLHMAVLTLYTNPKEPEKVTEIYQFRFKYTKKGTTMDFDSSST SFESGTDSEDIKKACSLLIRQLYILMQNLGPLPNDVILTMKLHYYNSVTPHDYQPPGFKEAVNSHFLLFE GEPVSLRMGSVSSGFHSMKVKVTTEATRMLDGENSVSQDDGTTEIAHQGLDCDEEEEACGSQVQRMNFVH IEPSFESSRKKKKVSEPVTVFIPNRK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 34.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083734 |
Locus ID | 75828 |
UniProt ID | Q5SQP1 |
Refseq Size | 1343 |
Cytogenetics | 11 A1 |
Refseq ORF | 918 |
Synonyms | 4930529M09Rik |
Summary | Essential for synapsis surveillance during meiotic prophase via the recruitment of ATR activity. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes. Required for the DNA double-strand break-independent, BRCA1-dependent activation of ATR on the sex chromosomes that is essential for normal sex body formation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Hormad2产品