Mtif3 (NM_029581) Mouse Recombinant Protein

CAT#: TP520522

Purified recombinant protein of Mouse mitochondrial translational initiation factor 3 (Mtif3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220522 protein sequence
Red=Cloning site Green=Tags(s)

MAVLLMRLMLQTTKLDHNLIGRCLQRHAVKPDPAQLSLSASTPKLLYLTSAKGFSTAGDPQGERKQKRRD
AFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSSEPPEYQLMTGEQIHQERLKL
REQEKAKPKTGPTMTKELVFSSNIGQHDLDTKSKQIQQWIEKKYHVQVTIKRRKDAEQSEEETEEIFNQI
LQTMPDIATFSSRPKAIRGGTASMCVFRHLSKKEEKAYRESQESQRRDTLSKDDDGNSKESDVVCQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083857
Locus ID 76366
UniProt ID Q9CZD5
Refseq Size 4979
Cytogenetics 5 G3
Refseq ORF 828
Synonyms 2810012L14Rik; AI414549
Summary IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...