Rab33a (NM_011228) Mouse Recombinant Protein

CAT#: TP519931

Purified recombinant protein of Mouse RAB33A, member RAS oncogene family (Rab33a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR219931 protein sequence
Red=Cloning site Green=Tags(s)

MAQPILGHGSLQPASAAGLASLELDSSMDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIG
VDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAV
PPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY
RDAERQQGKVQKLEFSQEANGKASCPC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035358
Locus ID 19337
UniProt ID P97950
Refseq Size 1183
Cytogenetics X A5
Refseq ORF 711
Synonyms Rab; Rabs10
Summary This gene encodes a member of the Ras-related small GTPases, which regulate membrane trafficking in organelles and transport vesicles. This protein has been reported to be expressed in lymphocytes and in regions of the mouse brain, specifically the cortex, hippocampus and also the olfactory bulb. The ortholog of this protein in rat has been characterized and may participate in anterograde trafficking of synaptophysin-positive vesicles to the plasma membrane. [provided by RefSeq, Jun 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...