Slc30a10 (NM_001033286) Mouse Recombinant Protein

CAT#: TP519373

Purified recombinant protein of Mouse solute carrier family 30, member 10 (Slc30a10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR219373 representing NM_001033286
Red=Cloning site Green=Tags(s)

MGRYSGKTCRLLFMLVLTAAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLGSGYIARRGPRGSSA
TYGYVRAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGALGLAVNVVGLLIFQDCGAC
FSRCTRGRRTRPSQQPSQGDPRGALGCPQEAATATAPGSGTAVTLRGSSAGRKQQEGATVFSNVAGDSLN
TENEPEETTKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVQPLRREDPCNWQCYIDPSLTVVMV
IIILSSAFPLIKETAVILLQMVPKGVNMEELMSQLSTVPGISSVHEVHIWELISGKIIATLHIKHQKGTE
YQDASRKIREIFHHAGIHNVTIQFETLDLKEALEQKDFLLTCSAPCITQSCAKKLCCPPGTLPLALVNGC
AEHNGRSSRESYRSIEAPEVAIDVDGCPREQGQTLSKTQERQHYENSTHF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 51.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001028458
Locus ID 226781
UniProt ID Q3UVU3
Refseq Size 5836
Cytogenetics 1 H5
Refseq ORF 1410
Synonyms E130106K10Rik; Gm212
Summary Plays a pivotal role in manganese transport. Manganese is an essential cation for the function of several enzymes, including some crucially important for the metabolism of neurotransmitters and other neuronal metabolic pathways. However, elevated levels of manganese are cytotoxic and induce oxidative stress, mitochondrial dysfunction and apoptosis. Acts as manganese efflux transporter and confers protection against manganese-induced cell death. Also acts as zinc transporter involved in zinc homeostasis. Seems to mediate zinc transport into early endosomes and recycling endosomes to prevent zinc toxicity; the function may be regulated by heterodimerization with other zinc transporters of the SLC30A subfamily. The SLC30A3:SLC30A10 heterodimer is involved in zinc transport-dependent regulation of the EGFR/ERK transduction pathway in endosomes. May be involved in regulation of zinc-dependent senescence of vascular smooth muscle cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...