Sco1 (NM_001040026) Mouse Recombinant Protein

CAT#: TP518719

Purified recombinant protein of Mouse SCO1 cytochrome c oxidase assembly protein (Sco1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
SCO1 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218719 representing NM_001040026
Red=Cloning site Green=Tags(s)

MAALVRAAVVRSQCRQLWRLFPRGHGLRDVAERPRPEEACSCLRSRAFSAGPPPPGAGPEPKGGQAGSHR
PKPGPVSWKSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDYLG
QWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGL
TGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSH
MKKR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001035115
Locus ID 52892
UniProt ID Q5SUC9
Refseq Size 4280
Cytogenetics 11 40.59 cM
Refseq ORF 852
Synonyms 2610001C07Rik; D11Bwg1310e
Summary Copper metallochaperone essential for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Not required for the synthesis of MT-CO2/COX2 but plays a crucial role in stabilizing MT-CO2/COX2 during its subsequent maturation. Involved in transporting copper to the Cu(A) site on MT-CO2/COX2 (By similarity). Plays an important role in the regulation of copper homeostasis by controlling the abundance and cell membrane localization of copper transporter CTR1 (PubMed:25683716, PubMed:28973536).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...