Polr3c (NM_028925) Mouse Recombinant Protein

CAT#: TP518709

Purified recombinant protein of Mouse polymerase (RNA) III (DNA directed) polypeptide C (Polr3c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218709 representing NM_028925
Red=Cloning site Green=Tags(s)

MTQAEIKLCSLLLQEHFGEIVEKIGVHLVRTGSQPLRVIAHDTKASLDQVKKALCVLIHHNLVLYHVHKR
GVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSAVVKKVADRLTETMEDGKTMD
YAEVSNAFVRLADTHFVQRCPLVPDTDSSDRGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAT
GEPKAKKPRYTDNKEPSPDDGIYWQVNLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTPSS
APYTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFIGKSGDSGGGMFVINLHKALASLATATLE
SVIQERFGSRCARIFRLVLQKKHLEQKQVEDFAMIPAKEAKDMLYKMLSENFILLQEIPKTPDHAPSRTF
YLYTVNVLSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIMASMQATGAEEVQLQEIEEMI
TAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIESTMKRQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 61.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083201
Locus ID 74414
UniProt ID Q9D483
Refseq Size 1796
Cytogenetics 3 F2.1
Refseq ORF 1599
Synonyms 4933407E01Rik; RPC3; RPC62
Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF-Kappa-B through the RIG-I pathway. Preferentially binds single-stranded DNA (ssDNA) in a sequence-independent manner.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...