Pofut2 (NM_030262) Mouse Recombinant Protein

CAT#: TP518637

Purified recombinant protein of Mouse protein O-fucosyltransferase 2 (Pofut2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218637 protein sequence
Red=Cloning site Green=Tags(s)

MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRVASLL
KTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVL
QGYAEGWKEGTWEEKVDARPCIDPLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNT
SARSVMLDRAENLLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVKL
GSALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRKEQEELRKLLPEMV
RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE
QPTHWKIAY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 49.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_084538
Locus ID 80294
UniProt ID Q8VHI3
Refseq Size 2219
Cytogenetics 10 C1
Refseq ORF 1287
Synonyms 2310011G23Rik; AI256847; BC003494; C21orf80; FUT13
Summary Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in the consensus sequence C1-X(2,3)-S/T-C2-X(2)-G of thrombospondin type I repeats (TSRs) where C1 and C2 are the first and second cysteines of the repeat, respectively. O-fucosylates members of several protein families including the ADAMTS superfamily and the thrombosporin (TSP) and spondin families. Required for the proper secretion of ADAMTS family members such as ADAMSL1 and ADAMST13 (By similarity). O-fucosylation of TSRs is also required for restricting epithelial to mesenchymal transition (EMT), maintaining the correct patterning of mesoderm and localization of the definite endoderm.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...