Mrpl28 (NM_024227) Mouse Recombinant Protein

CAT#: TP518599

Purified recombinant protein of Mouse mitochondrial ribosomal protein L28 (Mrpl28), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218599 protein sequence
Red=Cloning site Green=Tags(s)

MPLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKPHGTKFKINPKNGQRERVEDVPIPVH
YPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYG
FDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEE
ALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_077189
Locus ID 68611
UniProt ID Q9D1B9
Refseq Size 1080
Cytogenetics 17 A3.3
Refseq ORF 771
Synonyms 1110015G04Rik; L28mt; MAA; MAAT1; MRP-L28; p1; p15
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...