Cenpt (NM_177150) Mouse Recombinant Protein

CAT#: TP517951

Purified recombinant protein of Mouse centromere protein T (Cenpt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR217951 protein sequence
Red=Cloning site Green=Tags(s)

MADLSFSDGDPTVRTLLRRVLETADSRTPMRRRSTRINAQRRRSQTPYSNRQGSQTKTSARKQSHGARSV
GRSTRVQGRGRLEEQTPRTLLRNILLTAPESSTVMPDPVVKPAQVPEVARSSRRESSRGSLELHLPELEP
PSTLAPGLTAPGKRKQKLRLSVFQQEVDQGLPLSQEPRRSRSADVSSLASSFNLTFVLPGQPETVERPGL
ARRRPIRQLVNAGALLQDLEDNSLASALPGDSHRTPVAALPMDVGLEDTQPFSQSLAAFSLSGKHSLPSP
SRPGVEDVERVMGPPSSGTRLQSRMSRSGPAASPSPFLEPQPPPAEPREAVGSNEAAEPKDQEGSSGYEE
TSARPASGELSSSTHDSLPAEQPPPSPGVAVLSSEPLESVTAKCPSRTQTAGPRRRQDPHKAGLSPYVKF
FSFCTKMPVEKTALEIVEKCLDKYFQHLCNDLEVFASHAGRKIVKPEDLLLLMRRQGLVTDQVSQHVLVE
RYLPLEYRQQLIPCAFSGNSVFPAQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 56.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_796124
Locus ID 320394
UniProt ID Q3TJM4
Refseq Size 1767
Cytogenetics 8 D3
Refseq ORF 1545
Synonyms G630055P03Rik
Summary Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Part of a nucleosome-associated complex that binds specifically to histone H3-containing nucleosomes at the centromere, as opposed to nucleosomes containing CENPA. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. CENPT has a fundamental role in kinetochore assembly and function. It is one of the inner kinetochore proteins, with most further proteins binding downstream. Required for normal chromosome organization and normal progress through mitosis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...