H1f8 (NM_138311) Mouse Recombinant Protein

CAT#: TP517893

Purified recombinant protein of Mouse H1 histone family, member O, oocyte-specific (H1foo), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR217893 protein sequence
Red=Cloning site Green=Tags(s)

MAPGSVSSVSSSSFPSRDTSPSGSCGLPGADKPGPSCRRIQAGQRNPTMLHMVLEALKAREARQGTSVVA
IKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKLVPKPKTKKACAPKAGRGAA
GAKETGSKKSGLLKKDQVGKATMEKGQKRRAYPCKAATLEMAPKKAKAKPKEVRKAPLKQDKAAGAPLTA
NGGQKVKRSGSRQEANAHGKTKGEKSKPLASKVQNSVASLAKRKMADMAHTVTVVQGAETVQETKVPTPS
QDIGHKVQPIPRVRKAKTPENTQA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_612184
Locus ID 171506
UniProt ID Q8VIK3
Refseq Size 1114
Cytogenetics 6 E3
Refseq ORF 912
Synonyms C86609; H1; H1-8; H1.8; H1f; H1fo; H1foo; H1oo
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a replication-independent histone that is a member of the histone H1 family. This gene contains introns, unlike most histone genes and the encoded protein is expressed only in oocytes. [provided by RefSeq, Oct 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...