Hus1 (NM_008316) Mouse Recombinant Protein
CAT#: TP517345
Purified recombinant protein of Mouse HUS1 checkpoint clamp component (Hus1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR217345 representing NM_008316
Red=Cloning site Green=Tags(s) MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFFSEFQME GVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELQVSSSSSSRIVVHDIPIKVLP RRLWKDLQEPSIPDCDVSICLPALKMMKSVVEKMRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLE NPLLPSDSVSQNRHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPAL S myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 32.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032342 |
| Locus ID | 15574 |
| UniProt ID | Q8BQY8 |
| Refseq Size | 4581 |
| Cytogenetics | 11 5.74 cM |
| Refseq ORF | 843 |
| Summary | This gene encodes a component of a cell cycle checkpoint complex that causes cell cycle arrest in response to bulky DNA lesions and DNA replication blockage. Together with the proteins Rad9 and Rad1, the encoded protein forms a heterotrimeric complex known as the 9-1-1 complex. Mice lacking the encoded protein develop spontaneous chromosomal abnormalities resulting in embryonic lethality. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Documents
| FAQs |
| SDS |
