Slc14a1 (NM_028122) Mouse Recombinant Protein
CAT#: TP516943
Purified recombinant protein of Mouse solute carrier family 14 (urea transporter), member 1 (Slc14a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR216943 representing NM_028122
Red=Cloning site Green=Tags(s) MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNP ISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWW LIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWS ELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGL WGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTK NPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 42.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_082398 |
| Locus ID | 108052 |
| UniProt ID | Q8VHL0 |
| Refseq Size | 3675 |
| Cytogenetics | 18 E3 |
| Refseq ORF | 1152 |
| Synonyms | 2610507K20Rik; 3021401A05Rik; UT-B; Utb1 |
| Summary | Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Slc14a1产品
