Slc14a1 (NM_028122) Mouse Recombinant Protein

CAT#: TP516943

Purified recombinant protein of Mouse solute carrier family 14 (urea transporter), member 1 (Slc14a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR216943 representing NM_028122
Red=Cloning site Green=Tags(s)

MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNP
ISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWW
LIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWS
ELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGL
WGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTK
NPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082398
Locus ID 108052
UniProt ID Q8VHL0
Refseq Size 3675
Cytogenetics 18 E3
Refseq ORF 1152
Synonyms 2610507K20Rik; 3021401A05Rik; UT-B; Utb1
Summary Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...