Glrx2 (NM_023505) Mouse Recombinant Protein
CAT#: TP516026
Purified recombinant protein of Mouse glutaredoxin 2 (thioltransferase) (Glrx2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR216026 representing NM_023505
Red=Cloning site Green=Tags(s) MGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQD ALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_075994 |
Locus ID | 69367 |
UniProt ID | Q923X4 |
Refseq Size | 3482 |
Cytogenetics | 1 62.53 cM |
Refseq ORF | 369 |
Synonyms | 1700010P22Rik; AI645710; Grx2 |
Summary | Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...