Synj2bp (NM_025292) Mouse Recombinant Protein
CAT#: TP515747
Purified recombinant protein of Mouse synaptojanin 2 binding protein (Synj2bp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR215747 representing NM_025292
Red=Cloning site Green=Tags(s) MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNG QDLKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIVHRGEGEPSGVPVAMVLLPVFALTMVAVWAFVR YRKQL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079568 |
Locus ID | 24071 |
UniProt ID | Q9D6K5 |
Refseq Size | 10398 |
Cytogenetics | 12 37.73 cM |
Refseq ORF | 435 |
Synonyms | AA409442; ActRIP4; ARIP2; D12Wsu118e; OMP25 |
Summary | Isoform 1 regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction. Isoform 2 and isoform 3 show a stimulatory affect on activin-induced signal transduction and enhance activin type 2 expression at the cell surface.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Synj2bp产品