Ndufab1 (NM_028177) Mouse Recombinant Protein
CAT#: TP515726
Purified recombinant protein of Mouse NADH:ubiquinone oxidoreductase subunit AB1 (Ndufab1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR215726 representing NM_028177
Red=Cloning site Green=Tags(s) MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSD APPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMC PQEIVDYIADKKDVYE myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_082453 |
| Locus ID | 70316 |
| UniProt ID | Q9CR21 |
| Refseq Size | 800 |
| Cytogenetics | 7 F2 |
| Refseq ORF | 468 |
| Synonyms | 8kDa; 2210401F17Rik; 2310039H15Rik; 2610003B19Rik; 9130423F15Rik; ACP; CI-SDAP; SDAP |
| Summary | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Ndufab1产品
