S100a16 (NM_026416) Mouse Recombinant Protein
CAT#: TP515144
Purified recombinant protein of Mouse S100 calcium binding protein A16 (S100a16), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR215144 representing NM_026416
Red=Cloning site Green=Tags(s) MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRELNHMLTDTGNRKAADKLIQNLDANH DGRICFDEYWTMIGGITSPMANLIRQQECQQESQQECQQESQQESQQESQQGSS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 14.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080692 |
Locus ID | 67860 |
UniProt ID | Q9D708 |
Refseq Size | 1091 |
Cytogenetics | 3 F1 |
Refseq ORF | 372 |
Synonyms | 2300002L21Rik; AI325039; AI663996; DT1P1A7; S100F |
Summary | Calcium-binding protein. Binds one calcium ion per monomer (PubMed:17030513). Can promote differentiation of adipocytes (in vitro). Overexpression in 3T3-L1 preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (PubMed:21266506, PubMed:23526364).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它S100a16产品