Syce2 (NM_001168246) Mouse Recombinant Protein

CAT#: TP514964

Purified recombinant protein of Mouse synaptonemal complex central element protein 2 (Syce2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR214964 protein sequence
Red=Cloning site Green=Tags(s)

MERHGSWLRSQVAAPPVELKDQEPPAIVESGEHRQSENHEETPGSVAPSASCQLPGPFSSLDSSIETLKK
KAQELIENINESRQKDHALMTNFRDSLKMKVSDLTEKLEERMYQVYSHHSKIIQERLQEFTQKMAKINHL
EMELKQVCQTVETVYKDLCVQSEVPTCEEQNYKDGEC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001161718
Locus ID 71846
UniProt ID E9PYH4
Refseq Size 929
Cytogenetics 8 C3
Refseq ORF 531
Synonyms 1700013H19Rik; AA407907; Cesc1
Summary Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...