Spindoc (NM_001167831) Mouse Recombinant Protein

CAT#: TP514873

Purified recombinant protein of Mouse spindlin interactor and repressor of chromatin binding (Spindoc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR214873 representing NM_001167831
Red=Cloning site Green=Tags(s)

MALKAKGAAALDCFEVTLKCEEGDDDDEAVVVAVIPRPEPMLRVTQQEKTPPPRPNLLEAGVEGCEELKQ
QVSWEQEFLVGNSPGGSGRALCMVCGAEIRSPSADTARAHILEQHPHTLDLSPSEKSNILEAWSEGVALL
QDIQADQPSLPSLESGQDGQPDPISNPDPVRMPAEIVVLLDSEDNPSLPKRLRPRGLRPLELPVTPVIEQ
GNKKPRGQRWKESPENEPARKKRSRHMTKILDPDPDPPSPESPTETFAAPAEVRHFTDGSFPPGFVLQLF
SHTQLRTTDCKDSSKDSRAAEGLPQPQNPSSGEPC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001161303
Locus ID 68229
UniProt ID Q05AH6
Refseq Size 1594
Cytogenetics 19 A
Refseq ORF 945
Synonyms 1700105P06Rik; AI846148; SPIN-DOC
Summary Negatively regulates the transcriptional activator activity of SPIN1 via inhibition of its histone methyl-binding ability. Represses the expression of a number of SPIN1-regulated genes and the SPIN1-mediated activation of the Wnt signaling pathway (PubMed:29061846). Can also inhibit the histone methyl-binding abilities of SPIN2A, SPIN2B, SPIN3 and SPIN4 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...