Catsperz (NM_001039494) Mouse Recombinant Protein
CAT#: TP514418
Purified recombinant protein of Mouse cation channel sperm associated auxiliary subunit zeta (Catsperz), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR214418 representing NM_001039494
Red=Cloning site Green=Tags(s) MEESVKPVPKHANHRRSSVRSSLYGDVRDLWSTATMSTANVSVSDVCEDFDEEGKSVRNRIRKYSQTISI RDSLNLEPEEIQQQARRELELCHGRSLEHGEDHEESETSLASSTSESLIFSLWKPHRTYWTEQQNRLPLP LMELMETEVLDILKKALITYRSTIGRNHFMTKELQGYIEGIRKRRNKRLYFLDQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034583 |
Locus ID | 67077 |
UniProt ID | Q9CQP8 |
Refseq Size | 781 |
Cytogenetics | 19 A |
Refseq ORF | 582 |
Synonyms | 1700019N12Rik; A430107B04Rik; MLZ-622 |
Summary | Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation (PubMed:28226241, PubMed:31056283). Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization (PubMed:28226241, PubMed:31056283). Required for a distribution of the CatSper complex in linear quadrilateral nanodomains along the flagellum, maximizing fertilization inside the mammalian female reproductive tract (PubMed:28226241). Together with EFCAB9, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel (PubMed:31056283).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Catsperz产品