Tmem88 (NM_025915) Mouse Recombinant Protein
CAT#: TP514309
Purified recombinant protein of Mouse transmembrane protein 88 (Tmem88), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR214309 representing NM_025915
Red=Cloning site Green=Tags(s) MAEVPGAQRPVLAGGPEPRDPLDCWACAVLVTAQNLLVAVFNLLLLALVLGTILLPAVIMLGFGFLCHSQ FLRSQAPLCTSHLRDPGFTALLVTGFLLLVPLLVLALATYRRLCLRLRLADCLVPYSRALYRRRRIPQPK QIPVSPGSRSVPTPGKVWV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080191 |
Locus ID | 67020 |
UniProt ID | Q9D0N8 |
Refseq Size | 1585 |
Cytogenetics | 11 B3 |
Refseq ORF | 477 |
Synonyms | 2600017H02Rik |
Summary | Inhibits the Wnt/beta-catenin signaling pathway. Crucial for heart development and acts downstream of GATA factors in the pre-cardiac mesoderm to specify lineage commitment of cardiomyocyte development (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |