Aunip (NM_001081099) Mouse Recombinant Protein

CAT#: TP514067

Purified recombinant protein of Mouse aurora kinase A and ninein interacting protein (Aunip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR214067 representing NM_001081099
Red=Cloning site Green=Tags(s)

MRHRGPEEEACGVWLDAAALKRRKMQTHLIKLGTKMLPLLPGERKPNDPFTQRRGTRQTSIASFVTLQSG
MASGGNQKNIFSLKENQTNKECKRTQLDCLDDGLLSPLVTSAPADIQEAGHPRSPQISGCQGLEMSSLTM
MSLTQPDVLMGTGESKGPLDSSFSQYLERSCLLDQREAKRKGEGLRESKTDCPGMGSHIRPPGSKCHQPL
DKAEMGKRGPTKENRQAPVHLQTYRSGSCSRKKTLLVTESPCPLSLFPWDSERSDRDSWSQLFTEDSQGQ
QVIAHNTKMPFRDVTNARNQGSGQFPDSPQAQGQDGPAQLHLQSYLLFTQDSEGNRVIRH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001074568
Locus ID 69885
UniProt ID E9Q6Z5
Refseq Size 1270
Cytogenetics 4 D3
Refseq ORF 1020
Synonyms 2610002D18Rik; Clhc1
Summary DNA-binding protein that accumulates at DNA double-strand breaks (DSBs) following DNA damage and promotes DNA resection and homologous recombination. Serves as a sensor of DNA damage: binds DNA with a strong preference for DNA substrates that mimic structures generated at stalled replication forks, and anchors RBBP8/CtIP to DSB sites to promote DNA end resection and ensuing homologous recombination repair. Inhibits non-homologous end joining (NHEJ). Required for the dynamic movement of AURKA at the centrosomes and spindle apparatus during the cell cycle.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...