Them5 (NM_025416) Mouse Recombinant Protein

CAT#: TP512834

Purified recombinant protein of Mouse thioesterase superfamily member 5 (Them5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR212834 representing NM_025416
Red=Cloning site Green=Tags(s)

MLRTSFQGVARLVRHKALYRSPCLLPRVHLASAFGSSTESLVARFCPEKTDLKDYALPNASWCSDMLSLY
QEFLEKTKSGGWIKLPSFKSNRDHIQGLKLPFGLETASDKQDWRLFTRSIQLEGQGYEYVIFFHPSEKKS
VCLFQPGPYLEGAPGFAHGGSLAALMDETYSKTAYLAGEGLFTLSLNIKFKNLIPVGSLAVLDIQVEKIE
DQKLYMSCIAQSRDKQTVYAKSSGVFLQLQLEEQSQEQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079692
Locus ID 66198
UniProt ID Q9CQJ0
Refseq Size 1251
Cytogenetics 3 F2.1
Refseq ORF 744
Synonyms 1110007B02Rik; 1110038F21Rik
Summary Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleoyl-CoA and other unsaturated long-chain fatty acid-CoA esters (By similarity). Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin (PubMed:22586271). Required for normal mitochondrial function (PubMed:22586271).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...