Them5 (NM_025416) Mouse Recombinant Protein
CAT#: TP512834
Purified recombinant protein of Mouse thioesterase superfamily member 5 (Them5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR212834 representing NM_025416
Red=Cloning site Green=Tags(s) MLRTSFQGVARLVRHKALYRSPCLLPRVHLASAFGSSTESLVARFCPEKTDLKDYALPNASWCSDMLSLY QEFLEKTKSGGWIKLPSFKSNRDHIQGLKLPFGLETASDKQDWRLFTRSIQLEGQGYEYVIFFHPSEKKS VCLFQPGPYLEGAPGFAHGGSLAALMDETYSKTAYLAGEGLFTLSLNIKFKNLIPVGSLAVLDIQVEKIE DQKLYMSCIAQSRDKQTVYAKSSGVFLQLQLEEQSQEQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 27.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079692 |
| Locus ID | 66198 |
| UniProt ID | Q9CQJ0 |
| Refseq Size | 1251 |
| Cytogenetics | 3 F2.1 |
| Refseq ORF | 744 |
| Synonyms | 1110007B02Rik; 1110038F21Rik |
| Summary | Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleoyl-CoA and other unsaturated long-chain fatty acid-CoA esters (By similarity). Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin (PubMed:22586271). Required for normal mitochondrial function (PubMed:22586271).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
