Hba-a2 (NM_001083955) Mouse Recombinant Protein
CAT#: TP512474
Purified recombinant protein of Mouse hemoglobin alpha, adult chain 2 (Hba-a2), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Hba-a2" proteins (2)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR212474 representing NM_001083955
Red=Cloning site Green=Tags(s) MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANA AGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSK YR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001077424 |
| Locus ID | 110257 |
| UniProt ID | Q91VB8 |
| Refseq Size | 587 |
| Cytogenetics | 11 18.87 cM |
| Refseq ORF | 426 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
