Wrap73 (NM_021499) Mouse Recombinant Protein

CAT#: TP512163

Purified recombinant protein of Mouse WD repeat containing, antisense to Trp73 (Wrap73), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
Wdr8 Antibody - N-terminal region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR212163 representing NM_021499
Red=Cloning site Green=Tags(s)

MNFSESFKLSGLLCRFSPDGKYLASCVQYRLVIRDVTTLQILQLYTCLDQIQHIEWSADSLFILCAMYRR
GLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPKACQQGLT
FTRDGRYLALAERRDCRDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLD
GRLLSAYCAYEWSLGIKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEK
SPLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSSDSYFLASRND
NVPNAVWIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYLWSPAGCVSVQVPGEGDFPVLG
LCWHLSGDSLALLSKDHFCLCFLETKERVGTAYEQRDGMPRT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067474
Locus ID 59002
UniProt ID Q9JM98
Refseq Size 1600
Cytogenetics 4 E2
Refseq ORF 1386
Synonyms 2610044M17Rik; 5330425N03Rik; Dd57; Wdr8; Wrap73
Summary The SSX2IP:WRAP73 complex is proposed to act as regulator of spindle anchoring at the mitotic centrosome. Required for the centrosomal localization of SSX2IP and normal mitotic bipolar spindle morphology. Required for the targeting of centriole satellite proteins to centrosomes such as of PCM1, SSX2IP, CEP290 and PIBF1/CEP90. Required for ciliogenesis and involved in the removal of the CEP97:CCP110 complex from the mother centriole. Involved in ciliary vesicle formation at the mother centriole and required for the docking of vesicles to the basal body during ciliogenesis; may promote docking of RAB8A- and ARL13B-containing vesicles (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...