Mlh1 (NM_026810) Mouse Recombinant Protein

CAT#: TP510511

Purified recombinant protein of Mouse mutL homolog 1 (Mlh1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210511 protein sequence
Red=Cloning site Green=Tags(s)

MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQIQDNGTGIRK
EDLDIVCERFTTSKLQTFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLQAPPK
PCAGNQGTLITVEDLFYNIITRRKALKNPSEEYGKILEVVGRYSIHNSGISISVKKQGETVSDVRTLPNA
TTVDNIRSIFGNAVSRELIEVGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESAALRKAIETVY
AAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILQRVQQHIESKLLGSNSSRMYFTQTLLP
GLAGPSGEAARPTTGVASSSTSGSGDKVYAYQMVRTDSRDQKLDAFLQPVSSLVPSQPQDPAPVRGARTE
GSPERATREDEEMLALPAPAEAAAESENLERESLMETSDTAQKAAPTSSPGSSRKRHREDSDVEMVENAS
GKEMTAACYPRRRIINLTSVLSLQEEISERCHETLREMLRNHSFVGCVNPQWALAQHQTKLYLLNTTKLS
EELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEDDGPKEGLAEYIVEFLKKKAEMLADYF
SVEIDEEGNLIGLPLLIDSYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYILEEST
LSGQQSDMPGSTSKPWKWTVEHIIYKAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 84.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081086
Locus ID 17350
UniProt ID Q9JK91
Refseq Size 2598
Cytogenetics 9 60.92 cM
Refseq ORF 2280
Synonyms 1110035C23Rik; AI317206; AI325952; AI561766
Summary Heterodimerizes with Pms2 to form MutL alpha, a component of the post-replicative DNA mismatch repair system (MMR). DNA repair is initiated by MutS alpha (Msh2-Msh6) or MutS beta (MSH2-MSH3) binding to a dsDNA mismatch, then MutL alpha is recruited to the heteroduplex. Assembly of the MutL-MutS-heteroduplex ternary complex in presence of RFC and PCNA is sufficient to activate endonuclease activity of Pms2. It introduces single-strand breaks near the mismatch and thus generates new entry points for the exonuclease EXO1 to degrade the strand containing the mismatch. DNA methylation would prevent cleavage and therefore assure that only the newly mutated DNA strand is going to be corrected. MutL alpha (Mlh1-Pms2) interacts physically with the clamp loader subunits of DNA polymerase III, suggesting that it may play a role to recruit the DNA polymerase III to the site of the MMR. Also implicated in DNA damage signaling, a process which induces cell cycle arrest and can lead to apoptosis in case of major DNA damages. Heterodimerizes with Mlh3 to form MutL gamma which plays a role in meiosis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...