Appl1 (NM_145221) Mouse Recombinant Protein

CAT#: TP510175

Purified recombinant protein of Mouse adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (Appl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210175 representing NM_145221
Red=Cloning site Green=Tags(s)

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKERDLKEILTLKEVFQIASNDH
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF
FKMGSENLNGQLEEFLANIGTSVQNVRREMDGDVETMQQTIEDLEVASDPLYLPDPDPTKFPINRNLTRK
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPGGQSRPP
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTKS
ETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQV
TRLTFPLPCVVLYATHQENKRLFGFVLRTSGGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAEL
DRRASEKQKEIERVKEKQQKELSKQKQIEKDLEEQSRLIAASSRPNQAGSEGQLVLSSSQSEESDLGEEG
KKRESEA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 79.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_660256
Locus ID 72993
UniProt ID Q8K3H0
Refseq Size 6961
Cytogenetics 14 A3
Refseq ORF 2121
Synonyms 2900057D21Rik; 7330406P05Rik; AI585782; AW209077; BB022931; C88264; DIP13
Summary Multifunctional adapter protein that binds to various membrane receptors, nuclear factors and signaling proteins to regulate many processes, such as cell proliferation, immune response, endosomal trafficking and cell metabolism (By similarity) (PubMed:25328665, PubMed:25568335, PubMed:27219021). Regulates signaling pathway leading to cell proliferation through interaction with RAB5A and subunits of the NuRD/MeCP1 complex (By similarity). Functions as a positive regulator of innate immune response via activation of AKT1 signaling pathway by forming a complex with APPL1 and PIK3R1 (PubMed:25328665). Inhibits Fc-gamma receptor-mediated phagocytosis through PI3K/Akt signaling in macrophages (PubMed:25568335). Regulates TLR4 signaling in activated macrophages (PubMed:27219021). Involved in trafficking of the TGFBR1 from the endosomes to the nucleus via microtubules in a TRAF6-dependent manner. Plays a role in cell metabolism by regulating adiponecting and insulin signaling pathways (By similarity). Required for fibroblast migration through HGF cell signaling (PubMed:26445298). Positive regulator of beta-catenin/TCF-dependent transcription through direct interaction with RUVBL2/reptin resulting in the relief of RUVBL2-mediated repression of beta-catenin/TCF target genes by modulating the interactions within the beta-catenin-reptin-HDAC complex (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...