Racgap1 (BC010715) Mouse Recombinant Protein

CAT#: TP509580

Purified recombinant protein of Mouse Rac GTPase-activating protein 1 (cDNA clone MGC:11396 IMAGE:3602242), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209580 protein sequence
Red=Cloning site Green=Tags(s)

MDTTMVNLWTLFEQLVRRMEIINEGNESIEFIQVVKDFEDFRKKYQRTNQELEKFKDLLLKAETGRSALD
VKLKHARNQVDVEIKRRQRAEAECAKLEQQIQLIRDILMCDTSGSIQLSEEQKSALAFLNRGQASSGHAG
NNRLSTIDESGSILSDISFDKTDESLDWDSSLVKNFKMKKREKRRSNSRQFIDGPPGPVKKTCSIGSTVD
QANESIVAKTTVTVPSDGGPIEAVSTIETLPSWTRSRGKSGPLQPVNSDSALNSRPLEPRTDTDNLGTPQ
NTGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRLVSHPECRDRCPLPCIPPLVGTPVKIGEG
MLADFVSQASPMIPAIVVSCVNEIEQRGLTEAGLYRISGCDRTVKELKEKFLKVKTVPLLSKVDDIHVIC
SLLKDFLRNLKEPLLTFWLSKAFMEAAEITDEDNSTAAMYQAVSELPQANRDTLAFLMIHLQRVSQSPDT
KMDIANLAKVFGPTIVAHTVPNPDPVTMFQDIKRQLKVVERLLSLPLEYWNQFMMVDQENIDSQRGNGNS
TPRTPDVKVSLLGPVTTPEFQLVKTPLSSSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFFPAPYLK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 70.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 26934
UniProt ID Q9WVM1
Refseq Size 2913
Cytogenetics 15 F1
Refseq ORF 1884
Synonyms Band25, GTPase, MgcRacGAP, gtl11
Summary Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Required for proper attachment of the midbody to the cell membrane during cytokinesis. Plays key roles in controlling cell growth and differentiation of hematopoietic cells through mechanisms other than regulating Rac GTPase activity. Also involved in the regulation of growth-related processes in adipocytes and myoblasts. May be involved in regulating spermatogenesis and in the RACGAP1 pathway in neuronal proliferation. Shows strong GAP (GTPase activation) activity towards CDC42 and RAC1 and less towards RHOA. Essential for the early stages of embryogenesis. May play a role in regulating cortical activity through RHOA during cytokinesis. May participate in the regulation of sulfate transport in male germ cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...