Racgap1 (BC010715) Mouse Recombinant Protein
CAT#: TP509580
Purified recombinant protein of Mouse Rac GTPase-activating protein 1 (cDNA clone MGC:11396 IMAGE:3602242), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR209580 protein sequence
Red=Cloning site Green=Tags(s) MDTTMVNLWTLFEQLVRRMEIINEGNESIEFIQVVKDFEDFRKKYQRTNQELEKFKDLLLKAETGRSALD VKLKHARNQVDVEIKRRQRAEAECAKLEQQIQLIRDILMCDTSGSIQLSEEQKSALAFLNRGQASSGHAG NNRLSTIDESGSILSDISFDKTDESLDWDSSLVKNFKMKKREKRRSNSRQFIDGPPGPVKKTCSIGSTVD QANESIVAKTTVTVPSDGGPIEAVSTIETLPSWTRSRGKSGPLQPVNSDSALNSRPLEPRTDTDNLGTPQ NTGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRLVSHPECRDRCPLPCIPPLVGTPVKIGEG MLADFVSQASPMIPAIVVSCVNEIEQRGLTEAGLYRISGCDRTVKELKEKFLKVKTVPLLSKVDDIHVIC SLLKDFLRNLKEPLLTFWLSKAFMEAAEITDEDNSTAAMYQAVSELPQANRDTLAFLMIHLQRVSQSPDT KMDIANLAKVFGPTIVAHTVPNPDPVTMFQDIKRQLKVVERLLSLPLEYWNQFMMVDQENIDSQRGNGNS TPRTPDVKVSLLGPVTTPEFQLVKTPLSSSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFFPAPYLK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 70.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 26934 |
| UniProt ID | Q9WVM1 |
| Refseq Size | 2913 |
| Cytogenetics | 15 F1 |
| Refseq ORF | 1884 |
| Synonyms | Band25, GTPase, MgcRacGAP, gtl11 |
| Summary | Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Required for proper attachment of the midbody to the cell membrane during cytokinesis. Plays key roles in controlling cell growth and differentiation of hematopoietic cells through mechanisms other than regulating Rac GTPase activity. Also involved in the regulation of growth-related processes in adipocytes and myoblasts. May be involved in regulating spermatogenesis and in the RACGAP1 pathway in neuronal proliferation. Shows strong GAP (GTPase activation) activity towards CDC42 and RAC1 and less towards RHOA. Essential for the early stages of embryogenesis. May play a role in regulating cortical activity through RHOA during cytokinesis. May participate in the regulation of sulfate transport in male germ cells.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Racgap1产品
