Spdl1 (NM_027411) Mouse Recombinant Protein

CAT#: TP509383

Purified recombinant protein of Mouse spindle apparatus coiled-coil protein 1 (Spdl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209383 protein sequence
Red=Cloning site Green=Tags(s)

MEADITNLRNKLKECEDERLKAAHYGLQLLERQTELQSQLDKCHEEMMITAEKYNQEKHALQREVELKSR
MLDSLSCECEALKQQQKAQLEQLEVQLHRSHRQEVSDLKNKLENLKVELDEARLGEKQLKQKLDLQGELL
AHKSEELRLLSEQRVLSSMSSELLALQTELTAAEGVKNALKEEVNELQYKQEQLECLNTSLLHQVDRLKE
EKEEREREAVSYYNALEKARVENQDLQVQLGHALQQAADPNSKGNSLFAEVEDRRVAMERQLNLMKDKYQ
SLKKQNAFTRDQMNKMKLQISTLLRMRGSQTEFEQQERLFAMIEQKNGEIKHLLGEINKLEKFKNLYESM
ESRPSTSDTACVLEDSTYYSDLLQLKLDKLNKENESTKDELSIQRMKALFESQRALDIERKLFTNERHLQ
LSESENMKLRAKLDELKLKYEPEERIEVPVLKRRREVLPLNITTPEETEETAAASATEDGVSRLPPHREE
ESCLNSLKDNTVQWKQPASSCVQPASLSPHKNLHLDTQPKKEKKCVKLVDSPANIEVLHEQSGNTPNSPR
LTAESKLPTEVKERIETTSKLGKGACKKSHNIIYVSSKSAPETQCSQQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 70.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081687
Locus ID 70385
UniProt ID Q923A2
Refseq Size 2526
Cytogenetics 11 A4
Refseq ORF 1824
Synonyms 1700018I02Rik; 2600001J17Rik; 2810049B11Rik; AA409762; Ccdc99
Summary Required for the localization of dynein and dynactin to the mitotic kintochore. Dynein is believed to control the initial lateral interaction between the kinetochore and spindle microtubules and to facilitate the subsequent formation of end-on kinetochore-microtubule attachments mediated by the NDC80 complex. Also required for correct spindle orientation. Does not appear to be required for the removal of spindle assembly checkpoint (SAC) proteins from the kinetochore upon bipolar spindle attachment. Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...