Dach2 (NM_001142570) Mouse Recombinant Protein

CAT#: TP509355

Purified recombinant protein of Mouse dachshund family transcription factor 2 (Dach2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Goat Polyclonal Antibody against DACH2
    • 100 ug

CNY 5371.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209355 protein sequence
Red=Cloning site Green=Tags(s)

MAVSAPPVISATSSSAGVPGGLFRAEPLYSSPGEPPRLTPNMINSFMANNHNGSVLGGGIGGGSGGSSNT
NTNECRMVDMHGVKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKLKRLDISPVVCTVEQVRILRG
LGAIQPGVNRCKLITRKDFETLFTDCTNASSRPGRPPKRSLGVLQDNARLLPHAVPGLLSPGLITPTGIT
AAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSTTGGSESSWDKDKIQSPLAASGPQHGIAHAA
LAGQPGLGGAPTLNPLQQNHLLSNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAAQIH
SPLSRAGASVIKERIPESPSPAPSLEESHRPGSQTSSHPSSSVSSSPSQMDHHSERMVMMPNNREELIVD
QDNGQSIKKFQRDNKEEVPAQIPVMKSPLDKIQLAPGQALHPGFPGPFIFADSLSSVETLLTNIQGLLKV
ALDNARIQEKQIQQEKKELRIELFREREIRENLERQLAVELQSRSTMQKRLKKEKKAKRKLQEALEFESK
RREQVEQALKQATSGDSGLRMLKDSGIPDIEIENSGTPHDSAAMQA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 65.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001136042
Locus ID 93837
UniProt ID Q925Q8
Refseq Size 5991
Cytogenetics X 49.13 cM
Refseq ORF 1818
Synonyms 9430028N04Rik
Summary Transcription factor that is involved in regulation of organogenesis. Seems to be a regulator for SIX1 and SIX6. Seems to act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. Is recruited with SIX6 to the p27Kip1 promoter in embryonal retina. SIX6 corepression seems also to involve NCOR1, TBL1, HDAC1 and HDAC3. May be involved together with PAX3, SIX1, and EYA2 in regulation of myogenesis. In the developing somite, expression of DACH2 and PAX3 is regulated by the overlying ectoderm, and DACH2 and PAX3 positively regulate each other's expression. Probably binds to DNA via its DACHbox-N domain.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...