Cdyl (NM_001123386) Mouse Recombinant Protein

CAT#: TP508673

Purified recombinant protein of Mouse chromodomain protein, Y chromosome-like (Cdyl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
现货

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208673 protein sequence
Red=Cloning site Green=Tags(s)

MASEELYEVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGSLAR
ASRASPSNARKQISRSTHSTLSKTNSKALVVGKDHESKSSQLLAASQKFRKNPAPSLANRKNMDLAKSGI
KILVPKSPVKGRTSVDGFQGESPEKLDPVDQGAEDTVAPEVTAEKPTGALLGPGAERARMGSRPRIHPLV
PQVSGPVTAAMATGLAVNGKGTSPFMDALAANGTVTIQTSVTGVTAGKRKFIDDRRDQPFDKRLRFSVRQ
TESAYRYRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADDSKLVLLSAVGSVFCCGLD
FIYFIRRLTDDRKRESTKMADAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTP
YTTFGQSPDGCSTVMFPKIMGGASANEMLFSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCN
PVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 60.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001116858
Locus ID 12593
UniProt ID Q9WTK2
Refseq Size 3494
Cytogenetics 13 14.39 cM
Refseq ORF 1632
Synonyms AI325931
Summary Isoform 2: Chromatin reader protein that recognizes and binds histone H3 trimethylated at 'Lys-9', dimethylated at 'Lys-27' and trimethylated at 'Lys-27' (H3K9me3, H3K27me2 and H3K27me3, respectively) (PubMed:12947414). Part of multimeric repressive chromatin complexes, where it is required for transmission and restoration of repressive histone marks, thereby preserving the epigenetic landscape (PubMed:12947414). Required for chromatin targeting and maximal enzymatic activity of Polycomb repressive complex 2 (PRC2); acts as a positive regulator of PRC2 activity by bridging the pre-existing histone H3K27me3 and newly recruited PRC2 on neighboring nucleosomes (By similarity). Acts as a corepressor for REST by facilitating histone-lysine N-methyltransferase EHMT2 recruitment and H3K9 dimethylation at REST target genes for repression (By similarity). Involved X chromosome inactivation in females: recruited to Xist RNA-coated X chromosome and facilitates propagation of H3K9me2 by anchoring EHMT2 (PubMed:24144980). Required for neuronal migration during brain development by repressing expression of RHOA (PubMed:28076783). In addition to act as a chromatin reader, acts as a hydro-lyase (By similarity). Shows crotonyl-coA hydratase activity by mediating the conversion of crotonyl-CoA ((2E)-butenoyl-CoA) to beta-hydroxybutyryl-CoA (3-hydroxybutanoyl-CoA), thereby acting as a negative regulator of histone crotonylation (By similarity). Histone crotonylation is required during spermatogenesis; down-regulation of histone crotonylation by CDYL regulates the reactivation of sex chromosome-linked genes in round spermatids and histone replacement in elongating spermatids (PubMed:28803779). May have histone acetyltransferase activity; such activity is however unsure in vivo (PubMed:12072557).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...