Grb10 (NM_001177629) Mouse Recombinant Protein

CAT#: TP508633

Purified recombinant protein of Mouse growth factor receptor bound protein 10 (Grb10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208633 protein sequence
Red=Cloning site Green=Tags(s)

MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQPVHILRRLQEE
DQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKHDVKVFSEDGTSKVVEILTDMTARD
LCQLLVYKSHCVDDNSWTLVEHHPQLGLERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPVNFF
PDQMVNWCQQSNGGQAQLLQNFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSKEPRH
LQLLADLEESSIFYLIAGKKQYNAPNEHGMCIKPNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLKYGML
LYQNYRIPQRKGLPPPFNAPMRSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWRKRSTRMNILS
SQSPLHPSTLNAVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQ
ILPCEDDGQTFFTLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 61.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001171100
Locus ID 14783
UniProt ID Q60760
Refseq Size 4764
Cytogenetics 11 7.15 cM
Refseq ORF 1623
Synonyms 5730571D09Rik; AI325020; Meg1; mKIAA0207
Summary Adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. Binds to, and suppress signals from, activated receptors tyrosine kinases, including the insulin (INSR) and insulin-like growth factor (IGF1R) receptors. The inhibitory effect can be achieved by 2 mechanisms: interference with the signaling pathway and increased receptor degradation. Delays and reduces AKT1 phosphorylation in response to insulin stimulation. Blocks association between INSR and IRS1 and IRS2 and prevents insulin-stimulated IRS1 and IRS2 tyrosine phosphorylation. Recruits NEDD4 to IGF1R, leading to IGF1R ubiquitination, increased internalization and degradation by both the proteasomal and lysosomal pathways. A similar role in the mediation of ubiquitination has also been suggested with INSR. Negatively regulates Wnt signaling by interacting with LRP6 intracellular portion and interfering with the binding of AXIN1 to LRP6. Positive regulator of the KDR/VEGFR-2 signaling pathway. May inhibit NEDD4-mediated degradation of KDR/VEGFR-2.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...