Hspa14 (NM_015765) Mouse Recombinant Protein

CAT#: TP508190

Purified recombinant protein of Mouse heat shock protein 14 (Hspa14), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



  View other "Hspa14" proteins (2)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208190 representing NM_015765
Red=Cloning site Green=Tags(s)

MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSEREQVVGLAAKQSRIRHVSSTVVKVKQI
LGRSSADPQAQKYISESKCLVIEKNGKLRYEIDTGEETKLVNPEDVARLIFSKMKETAHSVLGSDANDVV
VTVPFDFGEKQKSALGEAAGAAGFNVLRLIHEPSAALLAYGIGQDHPTGKSNVLVFKLGGTSLSLSVMEV
NSGMYRVLSTNTSDNIGGAHFTDTLAQYLASEFQRLFKHDVRGNARAMMKLMNSAEVAKHSLSTLGSANC
FVDSLYEGQDFDCNVSRARFELLCSPLFNKCTEAIRELLRQTGFTADDINKVVLCGGSSRIPKLQQLIKD
LFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDSVMIECSAKDILVKGVDESGADRFTVLFPSGT
PLPARRQHTLQAPGRVSSVCLELYESEGKNSAKEEAKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLQV
TCTDQDTGKCEAITVEVAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_056580
Locus ID 50497
UniProt ID Q99M31
Refseq Size 1791
Cytogenetics 2 A1
Refseq ORF 1527
Synonyms 70kDa; Hsp70-4; HSP70L1; hsr.1; NST-1
Summary Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...