Mavs (NM_144888) Mouse Recombinant Protein

CAT#: TP508088

Purified recombinant protein of Mouse mitochondrial antiviral signaling protein (Mavs), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208088 protein sequence
Red=Cloning site Green=Tags(s)

MTFAEDKTYKYIRDNHSKFCCVDVLEILPYLSCLTASDQDRLRASYRQIGNRDTLWGLFNNLQRRPGWVE
VFIRALQICELPGLADQVTRVYQSYLPPGTSLRSLEPLQLPDFPAAVSGPSAFAPGHNIPDHGLRETPSC
PKPVQDTQPPESPVENSEQLLQTNSGAVARMSGGSLIPSPNQQALSPQPSREHQEQEPELGGAHAANVAS
VPIATYGPVSPTVSFQPLPRTALRTNLLSGVTVSALSADTSLSSSSTGSAFAKGAGDQAKAATCFSTTLT
NSVTTSSVPSPRLVPVKTMSSKLPLSSKSTAAMTSTVLTNTAPSKLPSNSVYAGTVPSRVPASVAKAPAN
TIPPERNSKQAKETPEGPATKVTTGGNQTGPNSSIRSLHSGPEMSKPGVLVSQLDEPFSACSVDLAISPS
SSLVSEPNHGPEENEYSSFRIQVDESPSADLLGSPEPLATQQPQEEEEHCASSMPWAKWLGATSALLAVF
LAVMLYRSRRLAQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_659137
Locus ID 228607
UniProt ID Q8VCF0
Refseq Size 3099
Cytogenetics 2 F1
Refseq ORF 1509
Synonyms cardif; D430028G21Rik; IPS-1; Visa
Summary Required for innate immune defense against viruses (PubMed:24037184). Acts downstream of DHX33, DDX58/RIG-I and IFIH1/MDA5, which detect intracellular dsRNA produced during viral replication, to coordinate pathways leading to the activation of NF-kappa-B, IRF3 and IRF7, and to the subsequent induction of antiviral cytokines such as IFN-beta and RANTES (CCL5) (PubMed:24037184). Peroxisomal and mitochondrial MAVS act sequentially to create an antiviral cellular state (By similarity). Upon viral infection, peroxisomal MAVS induces the rapid interferon-independent expression of defense factors that provide short-term protection, whereas mitochondrial MAVS activates an interferon-dependent signaling pathway with delayed kinetics, which amplifies and stabilizes the antiviral response (By similarity). May activate the same pathways following detection of extracellular dsRNA by TLR3 (By similarity). May protect cells from apoptosis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...