Scara5 (NM_028903) Mouse Recombinant Protein

CAT#: TP507870

Purified recombinant protein of Mouse scavenger receptor class A, member 5 (Scara5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
SCARA5 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207870 representing NM_028903
Red=Cloning site Green=Tags(s)

MDNKAMYLHTVSDRDNGSIFEEPFDGRSLSKLNLCEDGPCHKRRAGGCCTQLGSLSALKHAVLGLYLLVF
LILVGIFILAVSRPRSSPDDLKALTRNVNRLNESLRDMQLRLLQAPLQADLTEQVWKVQDALQNQTDSLL
ALAGLVQRLEGTLWGLHAQAAQTEQAMALLRDRTGQQSDSAQLELYQLQVESNRSQLLLQRHAGLLDGLA
RRVGVLGEELADVGGALRGLNHSLSYDVALHSTWLQDLQVLVSNASADTRRMRLVHMDMEMQLKQELATL
NVVTEDLRLKDWEHSIALRNITLAKGPPGPKGDQGNEGKEGKPGSPGLPGSRGLPGERGDPGLPGPKGDD
GKLGATGPMGMRGFKGDRGPKGEKGERGERAGDMDFTMIRLVNGSGPHQGRVEVFHDRRWGTVCDDGWDK
KDGDVVCRMLGFHGVEEVYRTARFGQGTGRIWMDDVNCKGTESSIFHCQFSKWGVTNCGHAEDAGVTCTV
P

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083179
Locus ID 71145
UniProt ID Q8K299
Refseq Size 3809
Cytogenetics 14 D1
Refseq ORF 1473
Synonyms 4932433F15Rik; 4933425F03Rik; AV278087; Tesr
Summary Ferritin receptor that mediates non-transferrin-dependent delivery of iron. Mediates cellular uptake of ferritin-bound iron by stimulating ferritin endocytosis from the cell surface with consequent iron delivery within the cell. Delivery of iron to cells by ferritin is required for the development of specific cell types, suggesting the existence of cell type-specific mechanisms of iron traffic in organogenesis, which alternatively utilize transferrin or non-transferrin iron delivery pathways. Ferritin mediates iron uptake in capsule cells of the developing kidney. Binds preferrentially ferritin light chain (FTL) compared to heavy chain (FTH1).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...