Ero1lb (NM_026184) Mouse Recombinant Protein

CAT#: TP507470

Purified recombinant protein of Mouse ERO1-like beta (S. cerevisiae) (Ero1lb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207470 protein sequence
Red=Cloning site Green=Tags(s)

MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCDIDSIDKFNTYKIFPKIKKLQERDYF
RYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGRSNKYSQAANSTKELDDCEQANKLGAIN
STLSNESKEAFIDWARYDDSQDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKP
RSVYRPLNPLAPSRGEDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNI
KEFRRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPYFERSIVDLYTGNVEDDADTKTLLLSIFQDT
KSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI
QNLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKALLQHRR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080460
Locus ID 67475
UniProt ID Q8R2E9
Refseq Size 4255
Cytogenetics 13 A1
Refseq ORF 1401
Synonyms 1300013B24Rik; 1700065B09Rik; AI447560; ero1-beta; Ero1b
Summary Oxidoreductase involved in disulfide bond formation in the endoplasmic reticulum. Efficiently reoxidizes P4HB/PDI, the enzyme catalyzing protein disulfide formation, in order to allow P4HB to sustain additional rounds of disulfide formation. Other protein disulfide isomerase family members can also be reoxidized, but at lower rates compared to P4HB, including PDIA2, PDIA3, PDIA4, PDIA6 and NXNDC12. Following P4HB reoxidation, passes its electrons to molecular oxygen via FAD, leading to the production of reactive oxygen species (ROS) in the cell (By similarity). Involved in oxidative proinsulin folding in pancreatic cells, hence required for glucose homeostasis in vivo.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...