Cpsf7 (NM_001164272) Mouse Recombinant Protein

CAT#: TP507383

Purified recombinant protein of Mouse cleavage and polyadenylation specific factor 7 (Cpsf7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207383 protein sequence
Red=Cloning site Green=Tags(s)

MSEGVDLIDIYADEEFNQDSEFNNTDQIDLYDDVLTAASQPSDDRSSSTEPPPPVRQEPAPKPNNKTPAI
LYTYSGLRSRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHK
LLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPP
SVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPAL
HLNPAFFPPPNATVGPPPDTYMKASTPYNHHGSRDSGPPPSTVSEAEFEEIMKRNRAISSSAISKAVSGA
SAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKRHRSRERSPS
RSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 51.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001157744
Locus ID 269061
UniProt ID Q8BTV2
Refseq Size 3577
Cytogenetics 19 A
Refseq ORF 1386
Synonyms 5730453I16Rik; AL022757; C330017N18Rik
Summary Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs. CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation. The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs. CPSF7 activates directly the mRNA 3'-processing machinery. Binds to pA signals in RNA substrates.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...