Taf1a (NM_021466) Mouse Recombinant Protein
CAT#: TP507231
Purified recombinant protein of Mouse TATA-box binding protein associated factor, RNA polymerase I, A (Taf1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR207231 representing NM_021466
Red=Cloning site Green=Tags(s) MMSDFGEELTKLAVAEDNPETSVLSKTGMHFPWLHKHVEAVVTGGKKRKDFAQTTSACLSFIQEALLKHQ WQQAAEYMHSYLQTLEDSDTDKRQAAPEIIWKLGSEILFYHPKSNVETFNSFADRMKNIGVLNYLKISLQ HALYLLHHGMLDDANRNLSKAETWRYGEKSSSQEVLINLVQAYKGLLQYYTWTRKKMELSKLDEDDYAYA AKTRTMLSQSCKTSTNICALVKTPGVWDPFVKSYVEMLEFYGDQDGAREMLTNYAYDEKFPSNPNAHVYL YEFLKREKAPRAKLISVLKILHEIVPSHTLMLEFHTLLRKSDTEEHQKLGLSVLFEVLDFAGCNKNITAW KYLAKYLKQILVGSHHEWVEEEWKSRRNWWPAFHFSFFWAKSDWKADTDLACEKAFVAGVLLGKGCKYFR YILKQDHETLKKKIKRMKKSVKKYTIVNPGVHT myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 52.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_067441 |
| Locus ID | 21339 |
| UniProt ID | P97357 |
| Refseq Size | 2430 |
| Cytogenetics | 1 H5 |
| Refseq ORF | 1359 |
| Synonyms | mTAFI48; TAFI48 |
| Summary | Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (pre-initiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
