Taf1a (NM_021466) Mouse Recombinant Protein

CAT#: TP507231

Purified recombinant protein of Mouse TATA-box binding protein associated factor, RNA polymerase I, A (Taf1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Rabbit Polyclonal Anti-Taf1a Antibody
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207231 representing NM_021466
Red=Cloning site Green=Tags(s)

MMSDFGEELTKLAVAEDNPETSVLSKTGMHFPWLHKHVEAVVTGGKKRKDFAQTTSACLSFIQEALLKHQ
WQQAAEYMHSYLQTLEDSDTDKRQAAPEIIWKLGSEILFYHPKSNVETFNSFADRMKNIGVLNYLKISLQ
HALYLLHHGMLDDANRNLSKAETWRYGEKSSSQEVLINLVQAYKGLLQYYTWTRKKMELSKLDEDDYAYA
AKTRTMLSQSCKTSTNICALVKTPGVWDPFVKSYVEMLEFYGDQDGAREMLTNYAYDEKFPSNPNAHVYL
YEFLKREKAPRAKLISVLKILHEIVPSHTLMLEFHTLLRKSDTEEHQKLGLSVLFEVLDFAGCNKNITAW
KYLAKYLKQILVGSHHEWVEEEWKSRRNWWPAFHFSFFWAKSDWKADTDLACEKAFVAGVLLGKGCKYFR
YILKQDHETLKKKIKRMKKSVKKYTIVNPGVHT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067441
Locus ID 21339
UniProt ID P97357
Refseq Size 2430
Cytogenetics 1 H5
Refseq ORF 1359
Synonyms mTAFI48; TAFI48
Summary Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (pre-initiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...