Tfap2c (NM_009335) Mouse Recombinant Protein

CAT#: TP507174

Purified recombinant protein of Mouse transcription factor AP-2, gamma (Tfap2c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Rabbit polyclonal anti-M Tfap2c antibody (N-term)
    • 400 ul

CNY 6314.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207174 protein sequence
Red=Cloning site Green=Tags(s)

MLWKITDNVKYEEDCEDRHDSSSNGNPRIPHLSSPGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQLAYS
QSADHYSHLGEAYAAAMNPLHQPAATGSQQQAWPGRQSQEGSSLASHHSRSASLIPHISGLEGGSVSARR
EVYRRSDLLLPHAHALEAGLAENLGLHEMAHPIEEVQNVDDAHLLLHDQTVIRKGPISMTKNPLGLPCQK
DLVGVVMNPSEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREK
LDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAEFPSKAVADYLTRPHLGGRNEMATRKSM
LLAAQQVCKEFTDLLHQDRTPNGNNRPAQVLEPNIQNCLSHFSLITHGFGSQAICAAVSAVQNYIKEALI
AIDKSYMNPGDQSPADSSKTMEKMEKHRK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 49.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033361
Locus ID 21420
UniProt ID Q61312
Refseq Size 2853
Cytogenetics 2 H3
Refseq ORF 1347
Synonyms AA409384; Ap-2.2; AP2gamma; Stra2; Tcfap2c
Summary Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...