Poglut1 (NM_172380) Mouse Recombinant Protein

CAT#: TP506123

Purified recombinant protein of Mouse protein O-glucosyltransferase 1 (Poglut1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206123 protein sequence
Red=Cloning site Green=Tags(s)

MERRAGSRLRAWMLLLLLCPVQGRQKDSGSKWKVFLDQINRALENYEPCSSQNCSCYHGVIEEDLTPFRG
GISRKMMAEVVRRKLGTHYQIIKNRLFREDDCMFPSRCSGVEHFILEVIHRLPDMEMVINVRDYPQVPKW
MEPTIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPLYPTGLGRWDLFREDLLRSAAQWPWEKKNSTAYFR
GSRTSPERDPLILLSRKNPKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLIDHCKYRYLFNFRGVAASFRF
KHLFLCGSLVFHVGDEWVEFFYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDIAQEIAKRGSQFIINHL
QMDDITCYWENLLTDYSKFLSYNVTRRKDYYQIVPRRLKTEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_759012
Locus ID 224143
UniProt ID Q8BYB9
Refseq Size 2835
Cytogenetics 16 B4
Refseq ORF 1176
Synonyms 9630046K23Rik; Clp46; Ktelc; Ktelc1; Ru; Rumi; w; wsnp
Summary This gene encodes a protein that can catalyze transfer of either UDP-glucose or UDP-xylose to epidermal growth factor (EGF) repeats, such as those found in Notch. Loss of this gene product results in embryonic lethality. Embryos have neural plate defects, heart defects, and truncations of their posterior axis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...