Ilkap (NM_023343) Mouse Recombinant Protein

CAT#: TP506110

Purified recombinant protein of Mouse integrin-linked kinase-associated serine/threonine phosphatase 2C (Ilkap), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206110 protein sequence
Red=Cloning site Green=Tags(s)

MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGSGGPLLFDDLPPAASGNSGSLATSGSQVV
KTEGKGAKRKAPEEEKNGGEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITQECNPPSS
LITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQK
PAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRD
GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDDKI
QTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVVRIGH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075832
Locus ID 67444
UniProt ID Q8R0F6
Refseq Size 1368
Cytogenetics 1 D
Refseq ORF 1176
Synonyms 0710007A14Rik; 1600009O09Rik; PP2C-DELTA
Summary Protein phosphatase that may play a role in regulation of cell cycle progression via dephosphorylation of its substrates whose appropriate phosphorylation states might be crucial for cell proliferation. Selectively associates with integrin linked kinase (ILK), to modulate cell adhesion and growth factor signaling. Inhibits the ILK-GSK3B signaling axis and may play an important role in inhibiting oncogenic transformation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...