Dpf2 (NM_011262) Mouse Recombinant Protein

CAT#: TP506101

Purified recombinant protein of Mouse D4, zinc and double PHD fingers family 2 (Dpf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206101 protein sequence
Red=Cloning site Green=Tags(s)

MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ
LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD
DSLGEFPVSNSRARKRIIEPDDFLDDLDDEDYEEDTPKRRGKGKSKSKGVSSARKKLDASILEDRDKPYA
CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS
KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNLCGTSENDDQLLFCDDCDR
GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035392
Locus ID 19708
UniProt ID Q61103
Refseq Size 3314
Cytogenetics 19 4.34 cM
Refseq ORF 1173
Synonyms 2210010M07Rik; BAF45D; Req; ubi-d4
Summary Plays an active role in transcriptional regulation by binding modified histones H3 and H4. Is a negative regulator of myeloid differentiation of hematopoietic progenitor cells (By similarity). Might also have a role in the development and maturation of lymphoid cells (PubMed:7961935). Involved in the regulation of non-canonical NF-kappa-B pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...