Efemp1 (BC031184) Mouse Recombinant Protein
CAT#: TP506053
Purified recombinant protein of Mouse epidermal growth factor-containing fibulin-like extracellular matrix protein 1 (cDNA clone MGC:37612, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR206053 protein sequence
Red=Cloning site Green=Tags(s) MATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDE CTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLA ANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKF SCMCPQGYEVVRSRTCQDINECETTNECREDEMCWNYHGGFRCYPRNPCQDHYVLTSENRCVCPVSNTMC RELPQSIVYKYMSIRSDRSVPSDIFQIQATMIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLS GPREYIVDLEMLTVSSIGTFRTSSVLRLTIIVGPFSF myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 43.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 216616 |
| UniProt ID | Q8BPB5 |
| Refseq Size | 1677 |
| Cytogenetics | 11 A3.3 |
| Refseq ORF | 1161 |
| Synonyms | MGC37612 |
| Summary | Binds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |

